वेबसाइट डीएनएस
वेबसाइट डीएनएस
इस टूल का उपयोग करके ऑनलाइन वेबसाइट के DNS रिकॉर्ड की जाँच करें
वेबसाइट डीएनएस
| प्रकार | मेज़बान | कक्षा | लक्ष्य | टीटीएल |
|---|---|---|---|---|
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
| A | lb.wordpress.com. | IN | 192.0.78.13 | 94 |
| A | lb.wordpress.com. | IN | 192.0.78.12 | 94 |
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
2023-09-28 18:15:58 पर अंतिम अपडेट
Unleash Your Aerial Potential: How to Air Roll Effectively
चिह्न
शीर्षक
Unleash Your Aerial Potential: How to Air Roll Effectively
विवरण
Soar to New Heights: How to Master Air Rolls in Rocket League Sideswipe for Ultimate Control Are you ready to elevate your Rocket League skills to unprecedented levels? Becoming proficient in the skill of performing mid-air rolls can offer you a significant advantage on the arena. In this guide, we will explore the domain of…
छवि
नवीनतम साइटें






