DNS موقع الويب
DNS موقع الويب
تحقق من سجل DNS للموقع عبر الإنترنت باستخدام هذه الأداة
DNS موقع الويب
| النوع | الهوست | التصنيف | الهدف | TTL |
|---|---|---|---|---|
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
| A | lb.wordpress.com. | IN | 192.0.78.13 | 94 |
| A | lb.wordpress.com. | IN | 192.0.78.12 | 94 |
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
| CNAME | ultimateaerialrollingmasteryrlsideswipetricks.wordpress.com. | IN | lb.wordpress.com. | 7198 |
اخر تحديث في 2023-09-28 18:15:58
Unleash Your Aerial Potential: How to Air Roll Effectively
الأيقونة
العنوان
Unleash Your Aerial Potential: How to Air Roll Effectively
الوصف
Soar to New Heights: How to Master Air Rolls in Rocket League Sideswipe for Ultimate Control Are you ready to elevate your Rocket League skills to unprecedented levels? Becoming proficient in the skill of performing mid-air rolls can offer you a significant advantage on the arena. In this guide, we will explore the domain of…
الصورة
اخر المواقع
